General Information

  • ID:  hor005308
  • Uniprot ID:  P56618
  • Protein name:  Diuretic hormone 1
  • Gene name:  NA
  • Organism:  Tenebrio molitor (Yellow mealworm beetle)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Tenebrio (genus), Tenebrioninae (subfamily), Tenebrionidae (family), Tenebrionoidea (superfamily), Cucujiformia (infraorder), Polyphaga (suborder), Coleoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SPTISITAPIDVLRKTWEQERARKQMVKNREFLNSLN
  • Length:  37
  • Propeptide:  SPTISITAPIDVLRKTWEQERARKQMVKNREFLNSLN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates fluid secretion by the Malpighian tubules. Increases cyclic AMP production
  • Mechanism:  Inhibited by antidiuretic factor A.
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P56618-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P56618-F1.pdbhor005308_AF2.pdbhor005308_ESM.pdb

Physical Information

Mass: 501333 Formula: C191H318N58O57S
Absent amino acids: CGHY Common amino acids: R
pI: 11.02 Basic residues: 7
Polar residues: 9 Hydrophobic residues: 12
Hydrophobicity: -76.22 Boman Index: -10551
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 84.32
Instability Index: 4374.32 Extinction Coefficient cystines: 5500
Absorbance 280nm: 152.78

Literature

  • PubMed ID:  8618894
  • Title:  Isolation and identification of a diuretic hormone from the mealworm Tenebrio molitor.
  • PubMed ID:  11893763
  • Title:   Antagonistic control of fluid secretion by the Malpighian tubules of Tenebrio molitor: effects of diuretic and antidiuretic peptides and their second messengers.